PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast08G060500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family VOZ
Protein Properties Length: 423aa    MW: 47031.4 Da    PI: 5.8213
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast08G060500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ418.11.5e-128893061217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalne.glpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspw 90 
                         p+ps++lgpkcalwdc rp++gse++qdyc+ +ha laln+ gl gt+pv+rp+gidlkdg+lf+al akvqgk+vgip+cegaat+kspw
  Brast08G060500.2.p  89 PSPSQYLGPKCALWDCGRPVRGSEECQDYCNPYHAGLALNDdGLQGTRPVMRPRGIDLKDGPLFDALCAKVQGKNVGIPVCEGAATSKSPW 179
                         89**************************************9799*********************************************** PP

                 VOZ  91 naaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldala 181
                         na+elfdlsllege++rewlffd+prrafesgnrkqrslpdy grgwhesrkqvmk+fgglk+syymdpqpss++ewhl+eyein+++ala
  Brast08G060500.2.p 180 NAPELFDLSLLEGESLREWLFFDRPRRAFESGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKKSYYMDPQPSSNYEWHLFEYEINDSNALA 270
                         ******************************************************************************************* PP

                 VOZ 182 lyrlelklvdekksakgkvskdsladlqkklgrlta 217
                         lyrle+k++d+k+s+k+k++++sl+++q+++++l+a
  Brast08G060500.2.p 271 LYRLEFKSSDAKRSVKSKLASSSLNEIQQQMVKLSA 306
                         **********************************87 PP

Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MRCFRTRLLS CISLQMYYID HELSIDDFLH GSNPDSLSNL QGIGLLEHQQ FNLPLDLEPP  60
NSYADANNSV QNTGDVLFHM SDLLTTMCPS PSQYLGPKCA LWDCGRPVRG SEECQDYCNP  120
YHAGLALNDD GLQGTRPVMR PRGIDLKDGP LFDALCAKVQ GKNVGIPVCE GAATSKSPWN  180
APELFDLSLL EGESLREWLF FDRPRRAFES GNRKQRSLPD YGGRGWHESR KQVMKDFGGL  240
KKSYYMDPQP SSNYEWHLFE YEINDSNALA LYRLEFKSSD AKRSVKSKLA SSSLNEIQQQ  300
MVKLSADSPG DNKRAARSKT KANQKDSNGN TYPALNVPNQ ASASSAYETV ALNIPKQASA  360
SNAYETASLN IPNQANTSNA YQEVSQVDEM AFLNENVMYG PHLPYGYPAE KGHFHWNPSD  420
GA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3762940.0AK376294.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3120B09.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568104.10.0PREDICTED: transcription factor VOZ1-like
SwissprotQ9SGQ01e-115VOZ1_ARATH; Transcription factor VOZ1
TrEMBLI1HHM20.0I1HHM2_BRADI; Uncharacterized protein
STRINGBRADI2G19820.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.21e-116vascular plant one zinc finger protein